Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

Product Description

Recombinant Mouse Group XV phospholipase A2 (Pla2g15) is available at Gentaur for Next week Delivery.

Gene Name: Pla2g15

Alternative Names : 1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2

Expression Region : 34-412aa

AA Sequence : AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 50.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine. Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen

Function : Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid

Involvement in disease :

Subcellular location : Secreted, Lysosome, Membrane, Peripheral membrane protein

Protein Families : AB hydrolase superfamily, Lipase family

Tissue Specificity : Detected in blood plasma (PubMed:20410020). Detected in alveolar macrophages (at protein level) (PubMed:16106046, PubMed:16880524, PubMed:19017977). Detected in heart, liver, spleen, kidney, thymus, brain and lung (PubMed:16880524).

Paythway :

Uniprot ID : Q8VEB4