Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial

Product Description

Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130), partial is available at Gentaur for Next week Delivery.

Gene Name: Sap130

Alternative Names : 130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130

Expression Region : 8410-1557aa

AA Sequence : PRKQQHVISTEEGDMMETNSTDDEKSAAKSLLVKAEKRKSPPKEYIDEEGVRYVPVRPRPPITLLRHYRNPWKAAYHHFQRYSDVRVKEEKKAMLQEIANQKGVSCRAQGWKVHLCAAQLLQLTNLEHDVYERLTNLQEGIIPKKKAATDDDLHRINELIQGNMQRCKLVMDQISEARDSMLKVLDHKDRVLKLLNKNGTVKKVSKLKRKEKV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 28.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes

Function : Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes (By similarity).

Involvement in disease :

Subcellular location : Nucleus

Protein Families : SAP130 family

Tissue Specificity :

Paythway :

Uniprot ID : Q8BIH0