Recombinant Mouse Interleukin-1 alpha (Il1a) (Active)

Product Description

Recombinant Mouse Interleukin-1 alpha (Il1a) (Active) is available at Gentaur for Next week Delivery.

Gene Name: Il1a

Alternative Names : Interleukin-1 Alpha; IL-1 Alpha; Il1a

Expression Region : 115-270aa

AA Sequence : SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 18 kDa

Storage Buffer : Lyophilized from a 0.2 ?m Filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 8.0

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mouse Interleukin-1 (IL-1) designates two proteins, IL-1? and IL-1?, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1? and IL-1? are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17.5 kDa.

Function : Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-1 family

Tissue Specificity :

Paythway :

Uniprot ID : P01582