Recombinant Mouse Interleukin-18 (Il18)

Product Description

Recombinant Mouse Interleukin-18 (Il18) is available at Gentaur for Next week Delivery.

Gene Name: Il18

Alternative Names : Interferon gamma-inducing factor (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma) (IL-18) (Igif)

Expression Region : 1-192aa

AA Sequence : MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : A proinflammatory cytokine primarily involved in polarized T-helper 1 cell and natural killer cell immune responses. Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex which activates NF-kappa-B, triggering synthesis of inflammatory mediators. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 cells and natural killer cells.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P70380