Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial

Product Description

Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial is available at Gentaur for Next week Delivery.

Gene Name: l2rb

Alternative Names : High affinity IL-2 receptor subunit betap70-75; CD122

Expression Region : 24-240aa

AA Sequence : ASAAVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 29.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

Function : Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Type I cytokine receptor family, Type 4 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P16297