Product Description
Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is available at Gentaur for Next week Delivery.
Gene Name: Klk1b22
Alternative Names : Beta-NGF-endopeptidase;Epidermal growth factor-binding protein type A;EGF-BP AGlandular kallikrein K22;mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22
Expression Region : 25-259aa
AA Sequence : ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 41.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Function : Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Involvement in disease :
Subcellular location :
Protein Families : Peptidase S1 family, Kallikrein subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P15948
Euro
British Pound
US Dollar