Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22)

Product Description

Recombinant Mouse Kallikrein 1-related peptidase b22 (Klk1b22) is available at Gentaur for Next week Delivery.

Gene Name: Klk1b22

Alternative Names : Beta-NGF-endopeptidase;Epidermal growth factor-binding protein type A;EGF-BP AGlandular kallikrein K22;mGK-22Nerve growth factor beta chain endopeptidaseTissue kallikrein 22

Expression Region : 25-259aa

AA Sequence : ILGGFKCEKNSQPWQVAVYYLDEYLCGGVLLDRNWVLTAAHCYEDKYNIWLGKNKLFQDEPSAQHRLVSKSFPHPDFNMSLLQSVPTGADLSNDLMLLRLSKPADITDVVKPIDLPTTEPKLGSTCLASGWGSINQLIYQNPNDLQCVSIKLHPNEVCVKAHILKVTDVMLCAGEMNGGKDTCKGDSGGPLICDGVLQGITSWGSTPCGEPNAPAIYTKLIKFTSWIKDTMAKNP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 41.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Function : Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Involvement in disease :

Subcellular location :

Protein Families : Peptidase S1 family, Kallikrein subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P15948