Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial

Product Description

Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial is available at Gentaur for Next week Delivery.

Gene Name: Klra3

Alternative Names : 5E6 Lymphocyte antigen 49c Short name: Ly-49c Nk2.1 T-cell surface glycoprotein Ly-49C Ly-49c, Ly49C

Expression Region : 70-266aa

AA Sequence : QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor on natural killer (NK) cells for class I MHC.

Function : Receptor on natural killer (NK) cells for class I MHC.

Involvement in disease :

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q64329