Product Description
Recombinant Mouse Killer cell lectin-like receptor 3 (Klra3), partial is available at Gentaur for Next week Delivery.
Gene Name: Klra3
Alternative Names : 5E6 Lymphocyte antigen 49c Short name: Ly-49c Nk2.1 T-cell surface glycoprotein Ly-49C Ly-49c, Ly49C
Expression Region : 70-266aa
AA Sequence : QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 27.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor on natural killer (NK) cells for class I MHC.
Function : Receptor on natural killer (NK) cells for class I MHC.
Involvement in disease :
Subcellular location : Membrane, Single-pass type II membrane protein
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q64329
Euro
British Pound
US Dollar