Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3)

Product Description

Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3) is available at Gentaur for Next week Delivery.

Gene Name: Fcgr3

Alternative Names : Fc-gamma RIII Short name: FcRIII CD_antigen: CD16

Expression Region : 31-215aa

AA Sequence : ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.

Function : Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P08508