Product Description
Recombinant Mouse Low affinity immunoglobulin gamma Fc region receptor III (Fcgr3) is available at Gentaur for Next week Delivery.
Gene Name: Fcgr3
Alternative Names : Fc-gamma RIII Short name: FcRIII CD_antigen: CD16
Expression Region : 31-215aa
AA Sequence : ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor.
Function : Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P08508
Euro
British Pound
US Dollar