Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Lymphocyte antigen 6E (Ly6e) is available at Gentaur for Next week Delivery.
Gene Name: Ly6e
Alternative Names : Stem cell antigen 2 Thymic shared antigen 1 Short name: TSA-1
Expression Region : 21-102aa
AA Sequence : LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 24.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in T-cell development.
Function : Involved in T-cell development
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : Q64253
