Product Description
Recombinant Mouse Lymphocyte antigen 96 (Ly96) is available at Gentaur for Next week Delivery.
Gene Name: Ly96
Alternative Names : ESOP-1 Protein MD-2
Expression Region : 19-160aa
AA Sequence : EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal Flag-Myc-tagged
Theoretical MW : 20.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds bacterial lipopolysaccharide (LPS) (PubMed:22532668). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS (PubMed:10725698).
Function : Binds bacterial lipopolysaccharide (LPS)
Involvement in disease :
Subcellular location : Secreted, extracellular space, Secreted
Protein Families :
Tissue Specificity : Highly expressed in spleen, bone marrow, thymus, liver, kidney, ovary and decidua. Detected at lower levels in testis, small intestine and skin.
Paythway :
Uniprot ID : Q9JHF9
Euro
British Pound
US Dollar