Recombinant Mouse Lymphocyte antigen 96 (Ly96)

Product Description

Recombinant Mouse Lymphocyte antigen 96 (Ly96) is available at Gentaur for Next week Delivery.

Gene Name: Ly96

Alternative Names : ESOP-1 Protein MD-2

Expression Region : 19-160aa

AA Sequence : EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal Flag-Myc-tagged

Theoretical MW : 20.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds bacterial lipopolysaccharide (LPS) (PubMed:22532668). Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS (PubMed:10725698).

Function : Binds bacterial lipopolysaccharide (LPS)

Involvement in disease :

Subcellular location : Secreted, extracellular space, Secreted

Protein Families :

Tissue Specificity : Highly expressed in spleen, bone marrow, thymus, liver, kidney, ovary and decidua. Detected at lower levels in testis, small intestine and skin.

Paythway :

Uniprot ID : Q9JHF9