Recombinant Mouse Major urinary protein 6 (Mup6)

Product Description

Recombinant Mouse Major urinary protein 6 (Mup6) is available at Gentaur for Next week Delivery.

Gene Name: Mup6

Alternative Names : Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1

Expression Region : 19-180aa

AA Sequence : EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Function : Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Calycin superfamily, Lipocalin family

Tissue Specificity : Abundant in the urine of adult male mice but absent from that of females.

Paythway :

Uniprot ID : P02762