Recombinant Mouse Pro-epidermal growth factor (Egf), partial (Active)

Product Description

Recombinant Mouse Pro-epidermal growth factor (Egf), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: Egf

Alternative Names : Pro-epidermal growth factor; Epidermal growth factor;EGF

Expression Region : 977-1029aa

AA Sequence : NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Sequence Info : Partial

Tag Info : C-terminal 6xHis-tagged

Theoretical MW : 7.2 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : EGF is a single-pass type I membrane protein,containing 8 LDL-receptor class B repeats and 9 EGF-like domains. EGF results in cellular proliferation, differentiation, and survival.EGF is a low-molecular-weight polypeptide first purified from the mouse submandibular gland, but since then found in many human tissues including submandibular gland, parotid gland. Salivary EGF, which seems also regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents.

Function : EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity).

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P01132