Recombinant Mouse Prohibitin (Phb), partial

Product Description

Recombinant Mouse Prohibitin (Phb), partial is available at Gentaur for Next week Delivery.

Gene Name: Phb

Alternative Names : B-cell receptor-associated protein 32 (BAP 32)

Expression Region : 1-40aa

AA Sequence : MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 8.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.

Function : Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).

Involvement in disease :

Subcellular location : Mitochondrion inner membrane

Protein Families : Prohibitin family

Tissue Specificity : Widely expressed in different tissues.

Paythway :

Uniprot ID : P67778