Recombinant Mouse Serine/threonine-protein kinase VRK1 (Vrk1)

Product Description

Recombinant Mouse Serine/threonine-protein kinase VRK1 (Vrk1) is available at Gentaur for Next week Delivery.

Gene Name: Vrk1

Alternative Names : Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1

Expression Region : 1-440aa

AA Sequence : MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 53.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity

Function : Serine/threonine kinase involved in Golgi disassembly during the cell cycle

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus, Cytoplasm, cytoskeleton, spindle

Protein Families : Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily

Tissue Specificity : Highly expressed in testis. Expressed in liver, kidney and muscle. Weakly expressed in thymus, bone marrow and spleen.

Paythway :

Uniprot ID : Q80X41