Euro
British Pound
US Dollar
Product Description
Recombinant Mouse Serum amyloid A-3 protein (Saa3) is available at Gentaur for Next week Delivery.
Gene Name: Saa3
Alternative Names :
Expression Region : 20-122aa
AA Sequence : RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 13.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Major acute phase reactant. Apolipoprotein of the HDL complex.
Function : Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in disease :
Subcellular location : Secreted
Protein Families : SAA family
Tissue Specificity : Found in various tissues.
Paythway :
Uniprot ID : P04918
