Recombinant Mouse Small proline-rich protein 2A (Sprr2a)

Product Description

Recombinant Mouse Small proline-rich protein 2A (Sprr2a) is available at Gentaur for Next week Delivery.

Gene Name: Sprr2a

Alternative Names :

Expression Region : 1-83aa

AA Sequence : MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane

Function : Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane (By similarity).

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Cornifin (SPRR) family

Tissue Specificity :

Paythway :

Uniprot ID : Q9CQK8