Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1)

Product Description

Recombinant Mouse Stromal cell-derived factor 2-like protein 1 (Sdf2l1) is available at Gentaur for Next week Delivery.

Gene Name: Sdf2l1

Alternative Names :

Expression Region : 29-211aa

AA Sequence : SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 24.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Endoplasmic reticulum lumen

Protein Families :

Tissue Specificity : Ubiquitously expressed with high expression in the testis, ovary, uterus, and low expression in heart and skeletal muscle.

Paythway :

Uniprot ID : Q9ESP1