Recombinant Mouse Transthyretin (Ttr)

Product Description

Recombinant Mouse Transthyretin (Ttr) is available at Gentaur for Next week Delivery.

Gene Name: Ttr

Alternative Names : Prealbumin

Expression Region : 21-147aa

AA Sequence : GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Function : Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Transthyretin family

Tissue Specificity : Detected in plasma (at protein level). Detected in liver.

Paythway :

Uniprot ID : P07309