Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial

Product Description

Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial is available at Gentaur for Next week Delivery.

Gene Name: Tnfrsf4

Alternative Names : OX40 antigen OX40L receptor CD_antigen: CD134

Expression Region : 20-211aa

AA Sequence : VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 37.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).

Function : Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P47741