Recombinant Mouse Vomeronasal secretory protein 1 (Lcn3)

Product Description

Recombinant Mouse Vomeronasal secretory protein 1 (Lcn3) is available at Gentaur for Next week Delivery.

Gene Name: Lcn3

Alternative Names : Lipocalin-3 Vomeronasal secretory protein I Short name: VNSP I

Expression Region : 19-182aa

AA Sequence : QDSSFLAFNNGNFSGKWFLKALVSEDDIPINKVSPMLILVLNNGDIELSITHMIYDQCLEVTTILEKTDVPGQYLAFEGKTHLQVQLSSVKGHYMLYCDGEIEGMRFLMTQLIGRDPQENLEALEEFKVFTQIKGLVAENLVILEQMEKCEPESFYELPSRPSE

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transport of lipophilic molecules, possible pheromone-carrier.

Function : Transport of lipophilic molecules, possible pheromone-carrier.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Calycin superfamily, Lipocalin family

Tissue Specificity : Specifically expressed in vomeronasal and posterior glands of the nasal septum, the ducts of which open into the lumen of the vomeronasal organ.

Paythway :

Uniprot ID : Q62471