Euro
British Pound
US Dollar
Product Description
Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731) is available at Gentaur for Next week Delivery.
Gene Name: MT2731
Alternative Names :
Expression Region : 1-81aa
AA Sequence : MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 9.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Antitoxin component of a toxin-antitoxin (TA) module. Neutralizes the effect of cognate toxin MT2730
Function : Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT2730 (By similarity).
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P9WJ10
