Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51)

Product Description

Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen (mpt51) is available at Gentaur for Next week Delivery.

Gene Name: mpt51

Alternative Names :

Expression Region : 27-299aa

AA Sequence : AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 44.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Function : May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Mycobacterial A85 antigen family

Tissue Specificity :

Paythway :

Uniprot ID : P9WQN6