Recombinant Naja kaouthia Alpha-cobratoxin

Product Description

Recombinant Naja kaouthia Alpha-cobratoxin is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Alpha-elapitoxin-Nk2a Short name:Alpha-EPTX-Nk2a Long neurotoxin 1 Siamensis 3

Expression Region : 1-71aa

AA Sequence : IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Theoretical MW : 37.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5 nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105 nM).2 Publications Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7 nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370 nM).However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446): is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release.

Function : Monomer

Involvement in disease :

Subcellular location : Secreted

Protein Families : Snake three-finger toxin family, Long-chain subfamily, Type II alpha-neurotoxin sub-subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P01391