Recombinant Neosartorya fumigata Hydrophobin (rodA)

Product Description

Recombinant Neosartorya fumigata Hydrophobin (rodA) is available at Gentaur for Next week Delivery.

Gene Name: rodA

Alternative Names : Rodlet protein

Expression Region : 19-159aa

AA Sequence : LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 28.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia.

Function : Cell wall protein regularly arranged in interwoven fascicules of clustered proteinaceous microfibrils, or rodlets, to form the outer spore coat protein. It is involved in resistance to environmental stress and may well be associated with conidial hydrophobicity. It is important in the morphogenesis of the dispersible conidia.

Involvement in disease :

Subcellular location : Secreted, cell wall

Protein Families : Fungal hydrophobin family

Tissue Specificity :

Paythway :

Uniprot ID : P41746