Product Description
Recombinant Neosartorya fumigata Peroxiredoxin Asp f3 (aspf3) is available at Gentaur for Next week Delivery.
Gene Name: aspf3
Alternative Names : Peroxisomal membrane protein pmp20 Thioredoxin reductase Allergen: Asp f 3
Expression Region : 1-168aa
AA Sequence : MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 34.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Allergen
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Required for virulence.
Involvement in disease :
Subcellular location :
Protein Families : Peroxiredoxin family, Prx5 subfamily
Tissue Specificity :
Paythway :
Uniprot ID : O43099
Euro
British Pound
US Dollar