Recombinant Neosartorya fumigata Peroxiredoxin Asp f3 (aspf3)

Product Description

Recombinant Neosartorya fumigata Peroxiredoxin Asp f3 (aspf3) is available at Gentaur for Next week Delivery.

Gene Name: aspf3

Alternative Names : Peroxisomal membrane protein pmp20 Thioredoxin reductase Allergen: Asp f 3

Expression Region : 1-168aa

AA Sequence : MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Allergen

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Required for virulence.

Involvement in disease :

Subcellular location :

Protein Families : Peroxiredoxin family, Prx5 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : O43099