Product Description
Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial is available at Gentaur for Next week Delivery.
Gene Name: crf1
Alternative Names : Crh-like protein 1 (Allergen: Asp f 9)
Expression Region : 42-233aa
AA Sequence : TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 28.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Secreted, cell wall
Protein Families : Glycosyl hydrolase 16 family, CRH1 subfamily
Tissue Specificity :
Paythway :
Uniprot ID : Q8J0P4
Euro
British Pound
US Dollar