Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial

Product Description

Recombinant Neosartorya fumigata Probable glycosidase crf1 (crf1), partial is available at Gentaur for Next week Delivery.

Gene Name: crf1

Alternative Names : Crh-like protein 1 (Allergen: Asp f 9)

Expression Region : 42-233aa

AA Sequence : TYTADFTSASALDQWEVTAGKVPVGPQGAEFTVAKQGDAPTIDTDFYFFFGKAEVVMKAAPGTGVVSSIVLESDDLDEVDWEVLGGDTTQVQTNYFGKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQTPMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPY

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 28.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Secreted, cell wall

Protein Families : Glycosyl hydrolase 16 family, CRH1 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q8J0P4