Recombinant Neosartorya fumigata Vacuolar protease A (pep2)

Product Description

Recombinant Neosartorya fumigata Vacuolar protease A (pep2) is available at Gentaur for Next week Delivery.

Gene Name: pep2

Alternative Names : Aspartic endopeptidase pep2 (Aspartic protease pep2)

Expression Region : 71-398aa

AA Sequence : SRHDVLVDNFLNAQYFSEISLGTPPQKFKVVLDTGSSNLWVPGSDCSSIACFLHNKYDSSASSTYKANGTEFAIKYGSGELSGFVSQDTLQIGDLKVVKQDFAEATNEPGLAFAFGRFDGILGLGYDTISVNKIVPPFYNMLDQGLLDEPVFAFYLGDTNKEGDNSEASFGGVDKNHYTGELTKIPLRRKAYWEVDFDAIALGDNVAELENTGIILDTGTSLIALPSTLADLLNKEIGAKKGFTGQYSIECDKRDSLPDLTFTLAGHNFTIGPYDYTLEVQGSCISSFMGMDFPEPVGPLAILGDAFLRKWYSVYDLGNNAVGLAKAK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 39.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.

Function : Vacuolar aspartic endopeptidase which is probably also secreted and contributes to virulence.

Involvement in disease :

Subcellular location : Vacuole lumen, Secreted

Protein Families : Peptidase A1 family

Tissue Specificity :

Paythway :

Uniprot ID : O42630