Product Description
Recombinant Newcastle disease virus Hemagglutinin-neuraminidase (HN), partial is available at Gentaur for Next week Delivery.
Gene Name: HN
Alternative Names :
Expression Region : 115-473aa
AA Sequence : NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 42.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins.
Function : Attaches the virus to sialic acid-containing cell receptors and thereby initiating infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion (By similarity).
Involvement in disease :
Subcellular location : Virion membrane, Single-pass type II membrane protein, Host cell membrane, Single-pass type II membrane protein
Protein Families : Paramyxoviruses hemagglutinin-neuraminidase family
Tissue Specificity :
Paythway :
Uniprot ID : P35741
Euro
British Pound
US Dollar