Recombinant Oncorhynchus mykiss Transforming growth factor beta-1 (TGFB1)

Product Description

Recombinant Oncorhynchus mykiss Transforming growth factor beta-1 (TGFB1) is available at Gentaur for Next week Delivery.

Gene Name: TGFB1

Alternative Names : Short name: TGF-beta-1

Expression Region : 271-382aa

AA Sequence : QTTTEEICSDKSESCCVRKLYIDFRKDLGWKWIHEPTGYFANYCIGPCTYIWNTENKYSQVLALYKHHNPGASAQPCCVPQVLEPLPIIYYVGRQHKVEQLSNMIVKSCRCS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Function : Likely to be an important cytokine regulating immune response. May also have a role in other physiological systems.

Involvement in disease :

Subcellular location : Secreted

Protein Families : TGF-beta family

Tissue Specificity : Expressed in blood leucocytes, kidney macrophages, brain, gill and spleen but not in liver.

Paythway :

Uniprot ID : O93449