Recombinant Oxyopes takobius Oxyopinin-4a

Product Description

Recombinant Oxyopes takobius Oxyopinin-4a is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Oxt-4a

Expression Region : 48-77aa

AA Sequence : GIRCPKSWKCKAFKQRVLKRLLAMLRQHAF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 19.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 µM) and B.subtilis (MIC=0.5 µM) as well as Gram-negative bacteria P.fluorescens (MIC=1 µM) and E.coli (MIC=0.5 µM). Has hemolytic activity against human erythrocytes (EC(50)=7 µM)

Function : Disrupts cell membranes through the formation of pores (Probable). Has antibacterial activity against Gram-positive bacteria S.aureus (MIC=10 uM) and B.subtilis (MIC=0.5 uM) as well as Gram-negative bacteria P.fluorescens (MIC=1 uM) and E.coli (MIC=0.5 uM). Has hemolytic activity against human erythrocytes (EC(50)=7 uM).

Involvement in disease :

Subcellular location : Secreted, Target cell membrane

Protein Families :

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : F8J4S0