Recombinant Phleum pratense Pollen allergen Phl p 5b

Product Description

Recombinant Phleum pratense Pollen allergen Phl p 5b is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Allergen Phl p Vb Allergen: Phl p 5b

Expression Region : 20-284aa

AA Sequence : ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 42.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has ribonuclease activity. May be involved in host-pathogen interactions.

Function : Has ribonuclease activity. May be involved in host-pathogen interactions.

Involvement in disease :

Subcellular location :

Protein Families : Poa p IX/Phl p VI allergen family

Tissue Specificity :

Paythway :

Uniprot ID : Q40963