Recombinant Phoneutria nigriventer Delta-ctenitoxin-Pn1a (PNTx4)

Product Description

Recombinant Phoneutria nigriventer Delta-ctenitoxin-Pn1a (PNTx4) is available at Gentaur for Next week Delivery.

Gene Name: PNTx4

Alternative Names : Insecticidal neurotoxin Tx4(6-1) Short name:PNTx4(6-1)

Expression Region : 35-82aa

AA Sequence : CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 7.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.

Function : This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation. The toxin inhibits glutamate uptake from rat brain synaptosomes. It is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Spider toxin Tx2 family

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P59368