Product Description
Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial is available at Gentaur for Next week Delivery.
Gene Name: IL4R
Alternative Names : CD_antigen: CD124
Expression Region : 33-240aa
AA Sequence : VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Sequence Info : Partial
Tag Info : N-terminal 6xHis-sumostar-tagged
Theoretical MW : 40.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2
Function : Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2 (By similarity).
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity :
Paythway :
Uniprot ID : Q863Z5
Euro
British Pound
US Dollar