Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial

Product Description

Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial is available at Gentaur for Next week Delivery.

Gene Name: IL4R

Alternative Names : CD_antigen: CD124

Expression Region : 33-240aa

AA Sequence : VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 40.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2

Function : Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2 (By similarity).

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Type I cytokine receptor family, Type 4 subfamily

Tissue Specificity :

Paythway :

Uniprot ID : Q863Z5