Recombinant Pig Rhodopsin (RHO), partial

Product Description

Recombinant Pig Rhodopsin (RHO), partial is available at Gentaur for Next week Delivery.

Gene Name: RHO

Alternative Names : RHO1

Expression Region : 1-36aa

AA Sequence : MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Sequence Info : Partial

Tag Info : N-terminal GST-tagged and C-terminal 6xHis-tagged

Theoretical MW : 34.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling

Function : Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment

Protein Families : G-protein coupled receptor 1 family, Opsin subfamily

Tissue Specificity :

Paythway :

Uniprot ID : O18766