Product Description
Recombinant Pig Rhodopsin (RHO), partial is available at Gentaur for Next week Delivery.
Gene Name: RHO
Alternative Names : RHO1
Expression Region : 1-36aa
AA Sequence : MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ
Sequence Info : Partial
Tag Info : N-terminal GST-tagged and C-terminal 6xHis-tagged
Theoretical MW : 34.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Function : Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families : G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity :
Paythway :
Uniprot ID : O18766
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          