Euro
British Pound
US Dollar
Product Description
Recombinant Platanus acerifolia Putative invertase inhibitor is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Pollen allergen Pla a 1 Allergen: Pla a 1
Expression Region : 24-179aa
AA Sequence : ADIVQGTCKKVAQRSPNVNYDFCVKSLGADPKSHTADLQGLGVISANLAIQHGSKIQTFIGRILKSKVDPALKKYLNDCVGLYADAKSSVQEAIADFKSKDYASANVKMSAALDDSVTCEDGFKEKKGIVSPVTKENKDYVQLTAISLAITKLLGA
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 18.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Allergen
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Invertase inhibitor.
Function : Invertase inhibitor.
Involvement in disease :
Subcellular location : Secreted
Protein Families : PMEI family
Tissue Specificity : Pollen and stem, but not leaves.
Paythway :
Uniprot ID : Q8GT41
