Product Description
Recombinant Pongo abelii Transthyretin (TTR) is available at Gentaur for Next week Delivery.
Gene Name: TTR
Alternative Names : Prealbumin
Expression Region : 21-147aa
AA Sequence : GPTGAGESKCPLMVKVLDAVRGSPAVNVAVNVFKRAADETWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFAANDSGPRRYTIAALLSPYSYSTTAVVTNPKE
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 29.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain
Function : Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
Involvement in disease :
Subcellular location : Secreted
Protein Families : Transthyretin family
Tissue Specificity : Detected in liver.
Paythway :
Uniprot ID : Q5NVS2