Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL)

Product Description

Recombinant Pseudomonas aeruginosa Lysyl endopeptidase (prpL) is available at Gentaur for Next week Delivery.

Gene Name: prpL

Alternative Names : Protease IVPvdS-regulated endoprotease

Expression Region : 212-462aa

AA Sequence : AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 42.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Lysine-specific endoprotease . Involved in corneal virulence.

Function : Lysine-specific endoprotease

Involvement in disease :

Subcellular location : Secreted

Protein Families : Peptidase S1 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9HWK6