Recombinant Pseudomonas aeruginosa Type III export protein PscF (pscF)

Product Description

Recombinant Pseudomonas aeruginosa Type III export protein PscF (pscF) is available at Gentaur for Next week Delivery.

Gene Name: pscF

Alternative Names : Pseudomonas secretion protein F

Expression Region : 2-85aa

AA Sequence : AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 16.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.

Function : Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages.

Involvement in disease :

Subcellular location : Secreted

Protein Families : MxiH/PrgI/YscF family

Tissue Specificity :

Paythway :

Uniprot ID : P95434