Product Description
Recombinant Pseudomonas putida Metapyrocatechase (xylE) is available at Gentaur for Next week Delivery.
Gene Name: xylE
Alternative Names : CatO2ase Catechol 2,3-dioxygenase
Expression Region : 1-307aa
AA Sequence : MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 55.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This protein is involved in the pathway toluene degradation, which is part of Xenobiotic degradation. View all proteins of this organism that are known to be involved in the pathway toluene degradation and in Xenobiotic degradation.
Function :
Involvement in disease :
Subcellular location :
Protein Families : Extradiol ring-cleavage dioxygenase family
Tissue Specificity :
Paythway :
Uniprot ID : P06622
 Euro
            
 British Pound
            
 US Dollar