Recombinant Pseudomonas putida Metapyrocatechase (xylE)

Product Description

Recombinant Pseudomonas putida Metapyrocatechase (xylE) is available at Gentaur for Next week Delivery.

Gene Name: xylE

Alternative Names : CatO2ase Catechol 2,3-dioxygenase

Expression Region : 1-307aa

AA Sequence : MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 55.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein is involved in the pathway toluene degradation, which is part of Xenobiotic degradation. View all proteins of this organism that are known to be involved in the pathway toluene degradation and in Xenobiotic degradation.

Function :

Involvement in disease :

Subcellular location :

Protein Families : Extradiol ring-cleavage dioxygenase family

Tissue Specificity :

Paythway :

Uniprot ID : P06622