Product Description
Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA (dsbA) is available at Gentaur for Next week Delivery.
Gene Name: dsbA
Alternative Names :
Expression Region : 23-214aa
AA Sequence : AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 25.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins .
Function : Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins (By similarity).
Involvement in disease :
Subcellular location : Periplasm
Protein Families : Thioredoxin family, DsbA subfamily
Tissue Specificity :
Paythway :
Uniprot ID : O52376
Euro
British Pound
US Dollar