Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA (dsbA)

Product Description

Recombinant Pseudomonas syringae pv. tomato Thiol:disulfide interchange protein DsbA (dsbA) is available at Gentaur for Next week Delivery.

Gene Name: dsbA

Alternative Names :

Expression Region : 23-214aa

AA Sequence : AEPIESGKQYVELTSAVPVAVPGKIEVIELFWYGCPHCYAFEPTINPWVEKLPSDVNFVRIPAMFGGPWDAHGQLFITLDTMGVEHKVHAAVFEAIQKGGKRLTDKNDMADFVATQGVNKDDFLKTFDSFAVKGKIAQYKELAKKYEVTGVPTMIVNGKYRFDLGSAGGPEKTLQVADQLIDKERAAAKAAK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins .

Function : Involved in disulfide-bond formation. Acts by transferring its disulfide bond to other proteins (By similarity).

Involvement in disease :

Subcellular location : Periplasm

Protein Families : Thioredoxin family, DsbA subfamily

Tissue Specificity :

Paythway :

Uniprot ID : O52376