Recombinant Pyruvate, phosphate dikinase (PPDK), partial

Product Description

Recombinant Pyruvate, phosphate dikinase (PPDK), partial is available at Gentaur for Next week Delivery.

Gene Name: PPDK

Alternative Names : Pyruvate, orthophosphate dikinase

Expression Region : 1-342aa

AA Sequence : MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 54.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.

Function : Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.

Involvement in disease :

Subcellular location :

Protein Families : PEP-utilizing enzyme family

Tissue Specificity :

Paythway :

Uniprot ID : P37213